PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do023208.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 148aa    MW: 16192.2 Da    PI: 9.0044
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do023208.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.7e-1473126558
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                 +r  rk+kNR +A+rsR+R+ a++ eLe++v  L aeN++L+k  eelk+ +a+
  Do023208.1  73 RRRERKMKNRDSAQRSRARRYAYVNELEKEVRLLRAENDELRKLCEELKEAAAE 126
                 7889*********************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-769133IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.31271122IPR004827Basic-leucine zipper domain
PfamPF001702.9E-1173124IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-1273125No hitNo description
SuperFamilySSF579596.06E-1073123No hitNo description
PROSITE patternPS0003607791IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MEPQWGEAEQ LVLWGAGTGS NDAAGAATCL CPATVAAAAP GTCVFPRHAL EQEMLRRADV  60
QLQGGGGGGG GDRRRERKMK NRDSAQRSRA RRYAYVNELE KEVRLLRAEN DELRKLCEEL  120
KEAAAEAPAR AKRAPHHHQL QRTSSASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974151.11e-33PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ84JK23e-14FD_ARATH; Protein FD
TrEMBLK3YJX79e-35K3YJX7_SETIT; Uncharacterized protein
STRINGSi014546m3e-34(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151931719